intTypePromotion=1
ADSENSE

Nghiên cứu một số đột biến thay thế amino axít (missense mutation) trên Gen CXCL1 ở người bị phơi nhiễm asen

Chia sẻ: Ni Ni | Ngày: | Loại File: PDF | Số trang:8

32
lượt xem
0
download
 
  Download Vui lòng tải xuống để xem tài liệu đầy đủ

Bài viết tiến hành phân tích 7 đột biến thay thế amino axít được tìm thấy trên gen CXCL1. Trong đó, 5 đột biến điểm được phát hiện và 2 đột biến mới vừa công bố gần đây liên quan đến hiện tượng phơi nhiễm asen của nhóm nghiên cứu.

Chủ đề:
Lưu

Nội dung Text: Nghiên cứu một số đột biến thay thế amino axít (missense mutation) trên Gen CXCL1 ở người bị phơi nhiễm asen

TẠP CHÍ Y DƢỢC HỌC QUÂN SỰ SỐ 2-2014 - KẾT QUẢ NGHIÊN CỨU CHƢƠNG TRÌNH KHCN KC.10/11-15<br /> <br /> Comment [ĐhCn1]:<br /> <br /> NGHIªN CỨU MỘT SỐ ĐỘT BIẾN THAY THẾ AMINO AXÍT<br /> (MISSENSE MUTATION) TRÊN GEN CXCL1 Ở NGƢỜI BỊ<br /> PHƠI NHIỄM ASEN<br /> Lê Bắc Việt1*; Trần Phương Thảo*; Tạ Thị Bình**<br /> Nguyễn Khắc Hải**; Nguyễn Huy Hoàng*<br /> TÓM TẮTT<br /> Ngày nay, những bệnh di truyền gây ra bởi các đột biến gen ngày càng trở nên phổ biến. Trong<br /> đó, những biến thể di truyền gây ra thay đổi một nuclotid trong trình tự gen dẫn đến thay thế một<br /> amino axít trong trình tự protein được gọi là đột biến thay thế amino axÝt (missense mutation). Loại<br /> đột biến này có khả năng gây tác động mạnh đến tính ổn định của mạng lưới liên kết hydro, liên kết<br /> ái lực... của cấu trúc, hoạt tính và một số đặc tính quan trọng khác của protein. Ngoài ra, chúng còn<br /> liên quan đến các điều kiện về bệnh lý và tính nhạy cảm đối với bệnh cũng như quá trình điều trị<br /> bằng thuốc. Trong nghiên cứu này, chúng tôi sử dụng các phần mềm tin sinh học để mô hình hóa<br /> cấu trúc không gian 3D protein, từ đó đưa ra một số dự đoán về ảnh hưởng và tác động của các đột<br /> biến đã được phát hiện trên gen CXCL1, trong đó có hai đột biến liên quan đến hiện tượng phơi<br /> nhiễm asen là P67T và A76T. Qua đó có thể hiểu thêm về mối tương quan giữa cấu trúc và chức<br /> năng của protein được mã hóa bởi gen CXCL1.<br /> * Từ khóa: Bệnh di truyền; Cấu trúc không gian 3D protein; Đột biến điểm; Gen CXCL1; Phơi<br /> nhiễm asen.<br /> <br /> INVESTIGATION OF SOME MISSENSE MUTATIONS OF THE<br /> CXCL1 GENE IN ARSENIC EXPOSURE INDIVIDUALS<br /> SUMMARY<br /> Nowadays, genetic diseases caused by mutagenesis become more and more abundant. Of which,<br /> genetic variants that lead to change of only one nucleotide in a gene sequence resulting in substitutions of<br /> one amino acid in a protein sequence, called by missense mutations.That kind of mutation can have a<br /> dramatic effect on stability, hydrogen bond network, structure, activity and some other characteristics of<br /> protein. Moreover, they are involved in many pathological conditions, disease susceptibility and drug<br /> treatment. In this study, based on some bioinformatics softwares about protein three-dimesion (3D) crystal<br /> modelling, we brought out predictions about effects and influences of all seven missense mutations of the<br /> CXCL1 gene, of which two mutations (P67T and A76T) that relate to arsenic exposure were recently<br /> detected. As the result, it is possible to understand much more about the relationships between genotype<br /> and phenotype of protein encoding by the CXCL1 gene.<br /> * Key words: Genetic diseases; Protein 3D structure modelling; Missense mutations; The CXCL1 gene;<br /> Arsenic exposure.<br /> * Viện Nghiên cứu Hệ Gen, Viện Hàn lâm Khoa học và Công nghệ Việt Nam<br /> ** Viện Y học Lao động và Vệ sinh Môi trường<br /> Người phản hồi (Corresponding): Nguyễn Huy Hoàng (nhhoang@igr.ac.vn)<br /> Ngày nhận bài: 25/12/2013; Ngày phản biện đánh giá bài báo: 20/1/2014<br /> Ngày bài báo được đăng: 21/1/2014<br /> <br /> 56<br /> <br /> TẠP CHÍ Y DƢỢC HỌC QUÂN SỰ SỐ 2-2014 - KẾT QUẢ NGHIÊN CỨU CHƢƠNG TRÌNH KHCN KC.10/11-15<br /> <br /> ĐẶT VẤN ĐỀ<br /> Những sai khác trong trình tự ADN ở<br /> người gây ra biến thể biểu hiện ra ngoài<br /> kiểu hình và tác dụng đến nhạy cảm đối với<br /> bệnh tật, phản ứng với sự thay đổi môi<br /> trường và quá trình điều trị bằng thuốc [2].<br /> Những biến thể di truyền có thể bao gồm<br /> thay đổi một vài hoặc chỉ một nucleotid,<br /> trường hợp thứ hai được gọi là “đa hình đơn<br /> nu” hay SNP (single nucleotide polymorphism).<br /> Về mặt kỹ thuật, một đa hình thể hiện một<br /> biến thể ADN được tìm thấy ở > 1% cộng<br /> đồng dân cư sống trong cùng một vùng [2].<br /> SNP là dạng biến thể di truyền phổ biến<br /> nhất ở người [3] và xảy ra thường xuyên<br /> với tần xuất 1/1.200 base trên một cộng<br /> đồng người [5]. Trong đó, SNP thường xảy<br /> ra trên vùng không mã hóa trên ADN genome<br /> [2], ngược lại, SNP xảy ra trên vùng mã hóa<br /> gây ra thay đổi trên trình tự amino axít của<br /> protein, hay còn gọi là sự thay thế amino<br /> axít hoặc còn có thể gây ra những đột biến<br /> dừng dịch mã (nonsense mutation)/cắt cụt<br /> protein (truncation mutation) [4].<br /> Những biến thể di truyền xảy ra trên các<br /> allen phụ và có tần suất < 0,5 - 1% cộng<br /> đồng dân cư là những đột biến hiếm gặp<br /> [6]. Ảnh hưởng về mặt chức năng protein<br /> của các đột biến hiếm gặp đang là chủ đềể<br /> của nhiều công trình nghiên cứu gần đây<br /> với mục tiêu hiểu rõ hơn về vai trò của đột<br /> biến hiếm gặp trên nhiều loại tính trạng với<br /> nhau [7]. Sự cần thiết phải tìm hiểu về tác<br /> động của đột biến thay thế amino axít trở<br /> nên rất rõ ràng khi chúng ta xem xét đến<br /> những bệnh di truyền. Chỉ cần thay đổi một<br /> amino axít trong trình tự có thể dẫn đến một<br /> loạt những sai khác trong quá trình chuyển<br /> hóa trong cơ thể và gây bệnh. Chúng ảnh<br /> hưởng trực tiếp lên cấu trúc đại phân tử<br /> protein, cấu trúc bậc 2, mạng lưới liên kết<br /> <br /> hydro, làm giảm tính mất ổn định và hoạt<br /> tính của protein [9]. Từ đó, những phương<br /> pháp tin sinh học nhằm phân tích ảnh<br /> hưởng của đột biến thay thế amino axÝt lên<br /> hoạt tính protein được phát triển dựa vào<br /> mô hình cấu trúc không gian 3D protein với<br /> mục tiêu đưa ra một mối liên quan giữa đột<br /> biến và nhạy cảm đối với bệnh.<br /> Trong nghiên cứu này, chúng tôi tiến<br /> hành phân tích 7 đột biến thay thế amino<br /> axít được tìm thấy trên gen CXCL1. Trong<br /> đó, 5 đột biến điểm được phát hiện [8] và 2<br /> đột biến mới vừa công bố gần đây liên quan<br /> đến hiện tượng phơi nhiễm asen của nhóm<br /> nghiên cứu [9]. Bên cạnh liên quan đến hiện<br /> tượng phơi nhiễm asen, các đột biến trên<br /> gen CXCL1 còn có khả năng gây ung thư<br /> cao thông qua việc tạo ra khối u ác tính như<br /> ung thư phổi, ung thư vú, ung thu buồng<br /> trứng, ung thư tuyến tiền liệt, ung thư bàng<br /> quang… [10]. Do dó, các kết quả phân tích<br /> rất có ý nghĩa dự đoán ảnh hưởng của 7<br /> đột biến này lên cấu trúc protein và mức độ<br /> nhạy cảm đối với các bệnh di truyền hay<br /> ung thư khác nhau.<br /> NGUYÊN LIỆU VÀ PHƢƠNG PHÁP<br /> NGHIÊN CỨU<br /> 1. Nguyên liệu nghiên cứu.<br /> Những mẫu bệnh nhân được chẩn đoán<br /> phơi nhiễm asen trước sinh và phương<br /> pháp xét nghiệm lấy dựa theo nghiên cứu<br /> trước đó về gen CXCL1 của Trần Phương<br /> Thảo và CS [9]. Sử dụng<br /> trình tự amino axít của protein CXCL1,<br /> CXCL2, CXCL3 ở người từ website<br /> http://www.ensembl.org. Ngoài ra, trình tự<br /> amino axít CXCL1, CXCL2, CXCL3 ở một<br /> số loài khác như chuột, khỉ, lợn cũng được<br /> thu thập để so sánh trình tự với mục đích<br /> tìm ra những amino axst có độ tương đồng<br /> cao giữa các loài với nhau cũng như amino<br /> axít có tính bảo thủ trong protein CXCL.<br /> Bảng 1: Đột biến thay thế amino axít được<br /> phát hiện trên gen CXCL1.<br /> <br /> 58<br /> <br /> Formatted: Indent: First line: 0.5 cm,<br /> Space Before: 3 pt, Line spacing:<br /> Multiple 1.15 li<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold, Expanded by 0.2 pt<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold, Expanded by 0.2 pt<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold, Italic<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold<br /> Formatted: Font: (Default) Arial, 10.5<br /> pt, Not Bold<br /> <br /> TẠP CHÍ Y DƢỢC HỌC QUÂN SỰ SỐ 2-2014 - KẾT QUẢ NGHIÊN CỨU CHƢƠNG TRÌNH KHCN KC.10/11-15<br /> <br /> MMDB thuộc website NCBI mã số “1MSG”<br /> [11].<br /> 1<br /> <br /> c.115A > G<br /> <br /> 2<br /> <br /> p.T39A<br /> <br /> 2<br /> <br /> c.152G > A<br /> <br /> 2<br /> <br /> p.G51E<br /> <br /> 3<br /> <br /> c.190T > C<br /> <br /> 2<br /> <br /> p.S64P<br /> <br /> 4<br /> <br /> c.217G > A<br /> <br /> 2<br /> <br /> p.E73K<br /> <br /> 5<br /> <br /> c.237G > T<br /> <br /> 3<br /> <br /> p.K79N<br /> <br /> 6<br /> <br /> g.1124G > A<br /> <br /> 3<br /> <br /> p.A76T<br /> <br /> 7<br /> <br /> g.984C > A<br /> <br /> 2<br /> <br /> p.P67T<br /> <br /> Mô hình cấu trúc protein CXCL1 được<br /> sử dụng từ dữ liệu Structure Summary<br /> <br /> Formatted: Indent: First line: 0.5 cm,<br /> Line spacing: Multiple 1.19 li<br /> Formatted: Indent: First line: 0.5 cm,<br /> Space Before: 4 pt<br /> <br /> 2. Phƣơng pháp nghiên cứu.<br /> Sử dụng phần m ềm ClustalW 2<br /> (http://www.ebi.ac.uk/Tools/msa/clustalw2/)<br /> để so sánh các trình tự amino axít. Phần<br /> mềm tin sinh học spdbv 4.10 và ViewerLite<br /> 4.2 được sử dụng để mô phỏng cấu trúc và<br /> phân tích ảnh hưởng của những đột biến<br /> thay thế amino axít trên gen CXCL1.<br /> <br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Expanded by 0.1 pt, Highlight<br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> <br /> KẾT QUẢ NGHIÊN CỨU VÀ BÀN LUẬN<br /> 1. So sánh trình tự amino axít.<br /> <br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> <br /> β1<br /> monCXCL1<br /> <br /> MARAALSAAPSNPRFLQVALLLLLLVATSRRAAGASVVTELRCQCLQTLQGIHPKNIQSV 60<br /> <br /> monCXCL3<br /> <br /> MARAALSAAPSNPRLLRVALLLLLLVASGQRAAGAPVATELRCQCLQTLQGIHPKNIQSV 60<br /> <br /> hCXCL3<br /> <br /> MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV 60<br /> <br /> hCXCL1<br /> <br /> MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV 60<br /> <br /> hCXCL2<br /> <br /> Formatted: Font: (Default) Arial, 9 pt,<br /> Highlight<br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV 60<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> pCXCL2<br /> <br /> MASAAIAASPCAPRFLRAALLLLLLVAAGRRTAGAPVGGELRCQCLQTVQGIHLKNIQDL 60<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> mouCXCL1<br /> <br /> ------- MIPATRS L L C A A L L LL ---AT SRL ATG A P I A N ELRCQCLQTMAGIHLKNIQSL 50<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> *.<br /> <br /> :* .*****<br /> <br /> *:.: ::**.:<br /> <br /> β2<br /> <br /> *********:<br /> <br /> *** ****.:<br /> <br /> α-helix<br /> <br /> monCXCL1<br /> <br /> NVKAPGPHCADTEVIATLKNGQKACLNPASPMVQKIIKKMLN----- 102<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> monCXCL3<br /> <br /> IVKAPGPHCAETEVIATLKNGQKACLNPASPMVQKIIEKILNKGSTG 107<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> hCXCL3<br /> <br /> NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN 107<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> hCXCL1<br /> <br /> NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN 107<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN 107<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> Formatted<br /> <br /> ...<br /> <br /> hCXCL2<br /> pCXCL2<br /> mouCXCL1<br /> <br /> KVTSPGPHCDQTEVIATLKNGQEVCLNPSAPMVKKIIEKMLNKSSAN 107<br /> KVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK- 96<br /> <br /> * ..**** :**********::.**:* :*:*:**::*:*:<br /> Hình 1: So sánh trình tự amino axít CXCL1, CXCL2 và CXCL3 của một số loài động vật.<br /> h: người (human); mon: khỉ (monkey); mou: chuột (mouse); p: lợn (pig). (Những vị trí xảy ra<br /> đột biến được inm đậm, những amino axít có độ tương đồng cao được bôi đen. Bôi đỏIn<br /> nghiêng là xoắn α-helix. Gạch chân là gấp nếp β).<br /> <br /> 59<br /> <br /> TẠP CHÍ Y DƢỢC HỌC QUÂN SỰ SỐ 2-2014 - KẾT QUẢ NGHIÊN CỨU CHƢƠNG TRÌNH KHCN KC.10/11-15<br /> <br /> 3 vùng có trình tự amino axít tương<br /> đồng cao chứa cấu trúc gấp nếp β1 và β2,<br /> trong đó, một vùng khá lớn lên đến 24<br /> amino axít có thể được coi là một vùng bảo<br /> thủ trên họ protein CXCL (hình 1). Do vậy,<br /> những đột biến nằm trong vùng bảo thủ này<br /> sẽ ảnh hưởng nhất định lên cấu trúc cũng<br /> như chức năng của protein CXCL1.<br /> Kết quả so sánh trình tự amino axit<br /> CXCL1, CXCL2 và CXCL3 giữa các loài với<br /> nhau chỉ ra 3 vùng có trình tự amino axit<br /> tương đồng cao chứa các cấu trúc gấp nếp<br /> β1 và β2, trong đó có một vùng khá lớn lên<br /> đến 24 amino axit có thể được coi là một<br /> vùng bảo thủ trên họ protein CXCL (hình 1).<br /> Do vậy, những đột biến nằm trong vùng bảo<br /> thủ này sẽ có những ảnh hưởng nhất định<br /> lên cấu trúc cũng như chức năng của<br /> protein CXCL1.<br /> 2. Mô hình cấu trúc protein CXCL1.<br /> Sau khi so sánh trình tự trình tự amino<br /> axít của protein CXCL1, chúng tôi tiến hành<br /> phân tích mô hình không gian 3D protein<br /> với khuôn mẫu là mô hình CXCL1 ở người<br /> được Kim và CS xây dựng thành công. Mô<br /> hình cấu trúc cơ bản bậc 2 của protein này<br /> cùng với các vị trí amino axit đột biến thể<br /> hiện ở hình 2. Gen CXCL1 ở người có kích<br /> thước khoảng 1.6 kb mã hóa cho 107 amino<br /> axít. Trong nghiên cứu xây dựng khuôn<br /> mẫu protein CXCL1, nhóm tác giả đã cắt bỏ<br /> 34 amino axít ở exon 1 mà không làm ảnh<br /> hưởng đến hoạt tính protein, đây cũng là một<br /> quá trình bình thường trong nghiên cứu xây<br /> dựng hình mẫu không gian 3D protein. Trong<br /> 7 đột biến thay thế (T39A, G51E, S64P, E73K,<br /> K79N, A76T, P67T)) đã tìm thấy, không có<br /> đột biến nào nằm ở exon 1, có thể biểu diễn<br /> được trên mô hình cấu trúc không gian 3D.<br /> <br /> Hình 2: Mô hình cấu trúc 3D protein CXCL1.<br /> Mô hình không gian 3D bậc 2 cho thấy<br /> protein CXCL1 bao gồm 1 cấu trúc xoắn<br /> α-helix và 2 cấu trúc gấp nếp β. Trong 7 đột<br /> biến, 4 vị trí amino nằm trên gấp nếp β2:<br /> S64, E73, A76 và K79 và 4 vị trí codon này<br /> đều nằm trên vùng được cho là bảo thủ của<br /> họ protein CXCL (hình 1). Do đó, có thể dự<br /> đoán được 4 đột biến tại những vị trí này sẽ<br /> có ảnh hưởng đáng kể lên cấu trúc protein<br /> CXCL1. Gen CXCL1 là một trong những<br /> gen bị ảnh hưởng bởi hiện tượng phơi<br /> nhiễm asen ở người bệnh, bên cạnh các<br /> gen khác đã được nghiên cứu như AS3MT<br /> và GST01... Tuy nhiên, gen mã hóa protein<br /> CXCL1 trên bệnh nhân phơi nhiễm asen còn<br /> hạn chế, phần lớn tập trung vào phương pháp<br /> biểu hiện protein, nghiên cứu tương tác giữa<br /> protein/receptor gây ung thư [10]. Cho đến<br /> nay, đã phát hiện được 7 đột biến trên gen<br /> CXCL1, các đột biến này phù hợp với nghiên<br /> cứu của chúng tôi.<br /> 3. So sánh, dự đoán ảnh hƣởng của<br /> đột biến.<br /> * Đột biến P67T và A76T:<br /> Đột biến P67T, do vị trí P67 không tạo<br /> liên kết hydro với các amino axít xung<br /> quanh, nên đột biến không làm thay đổi hệ<br /> thống liên kết hydro trong cấu trúc protein<br /> (hình 3A). Bên cạnh đó, tính axít và bazơ<br /> <br /> 59<br /> <br /> TẠP CHÍ Y DƢỢC HỌC QUÂN SỰ SỐ 2-2014 - KẾT QUẢ NGHIÊN CỨU CHƢƠNG TRÌNH KHCN KC.10/11-15<br /> <br /> cũng thay đổi khi chuyển từ proline thành<br /> threonine, gốc -OH đã tăng từ 6 lên 7 khiến<br /> pH giảm. Về phần đột biến A76T, đột biến<br /> này đã tạo ra sự thay đổi liên kết hydro. Cụ<br /> thể, tại vị trí T76 đã thêm một liên kết hydro<br /> nữa so với A76 (hình 3B). Một điểm đáng<br /> chú ý là ở vị trí codon này, A76 là một<br /> amino axít không ưa nước, nhưng khi bị<br /> thay thế bằng T76 thì không còn đặc tính<br /> không ưa nước nữa. Bên cạnh đó, khi xét<br /> về độ axÝt và bazơ, gốc -OH tăng từ 5 lên 6<br /> khiến pH tăng nhẹ.<br /> <br /> amino axít có trên cả 3 loại CXCL ở người,<br /> do đó, đột biến này có thể sẽ có ảnh hưởng<br /> nhất định lên cấu trúc, chức năng protein<br /> CXCL1. Ngược lại, đối với đột biến A76T,<br /> với những thay đổi rất đáng kể ở trên, có<br /> thể dự đoán đột biến này sẽ ảnh hưởng<br /> đáng kể lên cấu trúc và chức năng của<br /> protein CXCL1. Nếu tần suất xuất hiện đột<br /> biến này trên người bị phơi nhiễm asen > 1,<br /> có thể kết luận đột biến này là chỉ thị sinh<br /> học (biomarker) trong phát hiện phơi nhiễm<br /> asen trước sinh.<br /> * Đột biến G51E, E73K và K79N:<br /> Tương tự như 2 đột biến trên, chúng tôi<br /> so sánh cấu trúc của 3 đột biến này trên<br /> ViewerLite 4.2. Sở dĩ đặt 3 đột biến này vào<br /> cùng một nhóm, do cả 3 đột biến này đều<br /> phát hiện được trên bệnh nhân mắc ung<br /> thư màng trong dạ con [8].<br /> <br /> A<br /> I<br /> <br /> II<br /> <br /> A<br /> I<br /> <br /> II<br /> <br /> B<br /> I<br /> <br /> II<br /> <br /> Hình 3: So sánh cấu trúc 3D protein. A:<br /> Đột biến P67T; B: Đột biến A76T. IA, IB: Mô<br /> hình bình thường. IIA, IIB: Mô hình đột biến.<br /> Từ kết quả trên cho thấy, đột biến P67T<br /> không làm thay đổi quá nhiều cấu trúc<br /> protein, lại không nằm trên cấu trúc xoắn α<br /> hay gấp nếp β nào. Tuy nhiên, T67 lại là<br /> <br /> I<br /> <br /> B<br /> <br /> II<br /> <br /> 60<br /> <br />
ADSENSE

CÓ THỂ BẠN MUỐN DOWNLOAD

 

Đồng bộ tài khoản
2=>2