intTypePromotion=1
ADSENSE

Phát hiện đột biến gen F8 gây bệnh Hemophilia A bằng kỹ thuật PCR

Chia sẻ: _ _ | Ngày: | Loại File: PDF | Số trang:7

2
lượt xem
0
download
 
  Download Vui lòng tải xuống để xem tài liệu đầy đủ

Hemophilia A là bệnh di truyền lặn liên kết với giới tính, gen bệnh nằm trên nhiễm sắc thể X. Người mẹ mang gen bệnh cố khả năng truyền bệnh cho 50% con trai của họ, do vậy chủ yếu bệnh nhân là nam. Đề tài nghiên cứu nhằm xác định một số đột biến gen F8 gây bệnh hemophilia A.

Chủ đề:
Lưu

Nội dung Text: Phát hiện đột biến gen F8 gây bệnh Hemophilia A bằng kỹ thuật PCR

  1. (giáo dục nha khoa, súc miệng bằng dung dịch Fluor, 4. Nguyễn Anh Sơn (2010), Thực irạng bệnh sâu khám răng, trám bít các hố rãnh) phù hợp với học sinh răng, viêm lợi và mộỉ số yểu tố liên quan ở học sinh khối THC S. Tuy nhiên, các nội dung chưa đáp ứng được lớp 6 trường trung học cơ sờ thị trấn Hương Canh, huyện yêu cầu ca về số lượng và chất lượng do thiếu cơ sở Bình Xuyên, tỉnh Vĩnh Phúc, Luận văn thạc sỹ y tế công vật chất và nhân lực. cộng, Trường đại học Y tế cong cộng, Hà Nội. Triền khai chăm sóc răng miệng, giáo dục cách 5. Trần Văn Trường (2000), "Báo cáo công tác nha phòng chống, xử trí các bệnh răng miệng theo từng học đường", tr. 1. khối !ớp, giáo dục học sinh có học lực trung bình, kém, 6. Trần Văn Trường, Lâm Ngọc Ắn và Trịnh Đinh Hải (2001), Điều tra sức khỏe răng miệng toàn quốc, NXB Y đào tạo cho giáo viên và cha/m ẹ học sinh về chương học Hà Nội. trình nha học đường là rất cần thiết. Tồ chức các buồl 7. J.p. and S.G. Damle Bhavsar (1995), Dental caries sinh hoạt ngoại khỏa cho học sinh về chăm sóc RM, and oral hygiene amongst 12-14 years old handicapped và thực hiện khám bệnh SR, V L định kỳ 2 lần/năm cho children of Bombay, India. J Indian Soc Pedod Prev Dent, học sinh. Gia đinh và nhà trường cùng chung tay hành 1-3,13. động C SR M cho học sính. 8. Poul Erik Petersen và các cộng sự. (2004), "Effect TÀ I LIỆU T H A M KHẢO of a school-based oral health education programme in 1. Nguyễn Mạnh Hà (2010), Sâu răng và các biến Wuhan city, Peoples Republic of China", international chứng.Nha xuất bản Giáo dục trè-22. Dental Journal. 54, tr. 33-41. 2. Bệnh viện Răng hàm mặt Thành phố Hồ Chí Minh 9. Ronald Patrick và các cộng sự. (2006), "Reducing (2005), "Báo cáo hoạt động chương trình Nha học đường Oral Health Disparities: A focus on Social and Cultural năm 2005". Determinants", BMC Oral Health. 6 Sumptement (S4). 3. Khoa RHM Bệnh viện Nhi Đồng li Thành phố Hồ 10. W HO (1997), Oral health surey basic method. 4th Chỉ Minh, Cách khám răng cho cộng đồng, Bài giảng về Editison, Geneva, pp.25-28. chăm sóc sức khoẻ răng miệng. T hS : Bùi T h ị M inh Phượng Giảng viên bộ m ôn Hóa Sinh - Trường Đ ại học Y D ược Thái Bình H ư ớ ng d ẫn k h o a học: G S .T S Tạ T hành V ăn Trưởng bộ m ỗn Hóa sin h - Trường đ ạ i học Y Hà N ội T Ó M TẮT Hemophilia A là bệnh di truyền lặn liên kết với giới tính, gen bệnh nằm trên nhiễm sắc thể X. Người mẹ mang gen bệnh cố khả năng truyền bệnh cho 50% con trai của họ, do vậy chủ yếu bệnh nhân là nam. Với sự tiến bộ của kỹ thuật sinh học phân từ, hiện nay các nhà khoa học có thể xẩc định chính xác vị trí đột biến gen yểu tố víu (F8) gây bệnh hemophilia A tăng hiệu quả trong việc phòng ngừa bệnh tật đồng thời nâng cao chắt lượng chăm sóc súc khỏe trong cộng đồng. Đối tượng và phương pháp nghiên cứu: Nghiên cứu 60 bệnh nhân đã được chẩn đoán hemophilia A. Mục tiêu: Xác định một số đột biến gen F8 gây bệnh hemophilia A. Kểt quả: Kết quả cho thấy đã phát hiện được 90% (54/60) bệnh nhân hemophilia A có đột biến gen F8 bao gồm: đảo đoạn intron 22 là 35,2%, đột biến sai nghĩa là 20,4%, đột biến mất nucleotid là 11,1 %, đột biến vô nghĩa là 11,1%, đột biến thêm nucleotid là 11,1%, đột biển vị trí nối exon-intron là 5,55%, đột biến mất đoạn lớn là 5,55%. Kết luận: Đây là kỹ thuật hữu ích giúp ích cho việc phát hiện sớm cốc gen gây đột biến có hướng tư vấn chẩn đoán trướcAmng quả trình mang thai. Từ khóa: Hemophilia A, gen F8. SUMMARY _ DETECTION OF DISEASE - CAUSING GENE MUTATIONS IN HEMOPHILIA A BY PCR Hemophilia A is a recessive sex-linked disease, the gene caused the disease locates in X chromosome. An affected mother can deliver the disease to 50% o f her sons, thus most o f the patients are male. With the advance o f molecular biotechnology, scientists can correctly determine the location o f mutation o f Factor VIII (F8) gene causing Hemophilia A to increase the effect o f disease control and improve community health services. Subjects and methods: study subjects were 60 patients diagnosed with hemophilia A. Objective: The objective o f the study was to detect some F8 gene mutations causing hemophilia A. Results: The result showed that 90% (54/60) o f hemophilia A patients had F8 gene mutation included: 35.2% o f patients with intron 22 inversion mutation, 20.4% o f patients with missense mutation, 11.1% o f patients with nucleotid deletion mutation, 11.1% o f patients with nonsense mutation, 11.1 % o f patients with nucieotid insertion 467
  2. mutation, 5.55% o f patients with exon-intron connecting mutation and 5.55% o f patients with large section deletion mutation. Conclusion: This is a useful technique for early detection o f genes causing mutations to give counseling and diagnostic before and during pregnancy. Keyw ords: Hemophilia A, F8 gene. Đ Ặ T V Ấ N ĐỀ sau va chạm hay chảy máu một cách íự nhiên. Hemophilia A là bệnh rối ioạn đông máu, bệnh gây + Vị trí: Chảy máu trong khớp, cơ hoặc một sổ vị trí nên do thiếu hụt hay bát thường chức năng củã yếu tố khác. V III. Đ ây ià một bẹnh di truyền gen iặn íiên kết với + Tính chất; Thường chảy máu tái phát. nhiễm sac thể giới tính X. Việt N am là một nước cỏ tỷ + Tiền sừ: Có tiền sử chấy máu kéo dài hoặc trong lệ mắc bệnh hemophilia A trong cộng đồng khá cao. gia đinh có người thân bị chày máu khó cầm. Theo nghiên cứu cua Đ ỗ Trung Phấn năm 1996 tỳ lệ * Cận lâm sàng: mắc bệnh hemophilia A khoảng 25 - 60/1.000.000 + Định lượng yếu tố FV1II giảm dưới 30%. người. Hiện nay tại Việt Nam có khoảng 6000 bệnh - Thể nặng: Hoạt tính yếu tố FVIII < 1%. nhân hemophilia Ả trong đó chỉ có 30% được phát - Thể trung bình: Hoạt tính yếu tố F V II11-5%. hiện và điều trị, phương pháp điều trị chủ yếu íả sử - Thể nhẹ: Hoạt tính yếu tố FVIII 5-30% . đụng yếu tố V lỉí trong máu toàn phần (truyền trực tiếp + A P T T kéo dài. hoặc tách chiết) rất tốn kém mà hiệu qua không cao, + Thời gian máu chảy binh thường. đặc biệt có nguy cơ cao đối với các bệnh lây truyền + Số lượng tiểu cầu và độ tập trung tiểu cầu binh qua đường máu. Trên thể giới, các nha khoa học đã thường. phân tích gen của bệnh nhân hemophilia A và rất 2. Trang th iế t bị, dụng cụ nghiên cứu và hóa nhiều dạng đột biến gen yếu tố VIII (F8) được công bố. chất C ác nghiên cứu khẳng định dạng đột biến khác nhau 3. P hư ơ ng pháp và kỹ th u ậ t nghiên cứu sẽ gây những kiểu hình đặc trừng khác nhau. Bệnh Đối với bệnh nhân thể nặng: xác định hiện tượng nhân hemophilia A thề nặng thường gặp dạng đột biến đảo đoạn intron 22 bằng phừơng pháp Inversion PCR đảo đoạn intron 22 (chiếm 45-5Ò%),bệnh nhân (l-PCR). Không có đột biến đảo đoạn iníron 22, xác hemophilia A thề nhẹ và trung bình chủ yeu ià đột biến định đao ổoạn intron 1 bằng phương pháp Multiplex điểm (chiếm 90-95% ). ở v ĩệ t Nam, các công trình PCR. Nếu vẫn không xác định được thì ta khuyếch đại nghiên cứu về bệnh hemophilia A chủ yểu là nghiên toàn bộ 26 exon để tim đột biển mất exon. Nếu không cứu yề đặc điềm lâm sàng, cận lâm sàng, đánh giá tỷ có đột biến, phân tích đột biến điềm bằng phương iệ mắc bệnh hoặc đánh giá hiệu quả điều trị bệnh bằng pháp giải trình tự gen. các chế phẩm thay thế.T. Với sự tiến bộ của kỹ thuật Đoi với bệnh nhân thể vừa và nhẹ sử dụng sinh học phân tử, các nhà khoa học có thể phân tích phương pháp P C R để xác định đột biến mất exon, nếu D NA của người bệnh để xác định chính xác các tổn không đột biến thì giải trinh tự gen trực tiếp để phát thương gen gây bệnh hemophilia A, cũng như kiểm hiện các dạng đột bien điểm. soát bệnh tốt hơn nhờ phát hiện người phụ nữ mang 3.1. QŨy trình lẩ y mẫu gen bệnh và tư vấn di truyền trưởc hôn nhân, tăng Bệnh nhân đã chẩn đoán hemophilia A được iấy hiệu quả trong việc phòng ngừa bệnh tật đông thời 5ml máu tĩnh mạch, cho vào ống chống đông EDTA nâng cao chất lượng chăm sóc sức khỏe trong cộng với hàm lượng 1,5mg/mL. Q uy trinh lấy máu đảm bảo đồng. vô írùng tuyệt đối. Mục tiêu của đề tài: 3.2. Quy trình tách ch iế t DNA từ máu ngoại v i 1. Xác định mộỉ sổ đột biến trên gen F8 gây bệnh 3.3. Xác định đ ộ t biến gen F8 hemophilia Á. 3.3.1. Xác định đột biến đảo đoạn intron 22 bằng kỹ 2. Mối liên quan giữa thể bệnh với một số đột biến thuật l - P C R ' gây bệnh hemophilia A ở Việt Nam. k ỹ thuật l-PC R gồm 3 bước: (1) c ắ t DNA bằng ĐỐI TƯ Ợ NG VÀ PHƯ Ơ NG PHÁP enzyme Bell, (2) NỐI bằng T 4 ligate, (3) Khuyếch đại 1. ĐỐI tứ ợ ng nghiên cứu bằng phản ưng multiplex PCR. Phương pháp I-PCR Nhỏm đối chứng: gòm 20 người (10 nam, 10 nữ) có ưu điểm là dễ tiến hành. Enzyme Bell tác dụng rất khỏe mạnh, tiền sử gia đình không có ngườỉ mắc bệnh đặc hiệu nên sản phẩm cắt enzym e có tính đạc hiệu di truyền. Nhóm chứng dùng để chuẩn hóa kỹ thuật và cao. San phẩm P C R được khuyếch đại dễ dàng trong làm mẫu đối chứng cung với mẫu nghiên cứu để khi thời gian khoảng 30 phút do các đoạn DNA có kích thực hiện các kỹ thuật sinh học phân tử để phân tích thước ngắn (487 và 559pb). Như vậy xét nghiệm phân gen. tích gen được tiến hành nhanh chóng, kết quả ỉhụ Nhóm nghiên cứu: 60 bệnh nhân được chẩn đoán được có độ tín cậy cao, dễ thực hiện. xác ổịnh hemophillia A tại Viện Nhi Trung ương và 3.3.2. Phát hiện đột biến đảo đoạn intron 1 bằng kỹ Viện Huyểt học Truyền máu Trung ương. ỉhuật multiplex PCR Tiêu chuẩn lựa chọn: k ỹ thuật multiplex PCR: Thiết kể hai phản ứng * Lâm sàng: multiplex P C R cố thể phát hiện được các bệnh nhân bị + Chảy máu: Chảy máu khó cầm sau chấn thương, đột biến: phản ứng 1 có chưa các cặp mồi đặc hiệu 468
  3. cho Ĩnt1h1 cộng với một mồi đặc hiệu cho chuỗi Ỉn1h2, - Thể nhẹ: 4/5 bệnh nhân phát hiện được đột biến phản ứng 2 chứa cặp mồi đặc hiệu int1h2 cộng với chiếm tỷ lệ 80% , 1/5 bệnh nhân chưa phát hiện được một mồi đặc hiệu cho intl h1. Dựa vào kích thước khác đột biến chiếm 20% . nhau của các đoạn D NA sau khi điện di để phát hiện 3. K ết quả p h á ỉ h iện các d ạng đ ộ t biến gen F8 đột biến. 3.1. K ế t quả xác định đ ộ t biến đảo đoạn 3.3.3. Phất hiện đột biến mất exon bằng kỹ thuật 3.1.1. Kết quả xấc định đột biến đảo đoạn íntron 22 PCR bằng kỹ thuật Inversion PCR Phản ứng P C R sử dụng cặp mồi đặc hiệu để 45 bệnh nhân hemophillia A chẩn đoán trên lâm khuếch đại từng exon của gen F8, sau đó điện di trên sàng thể nặng được xét nghiệm đột biến đảo đoạn gel agarose, mẫu bệnh nhân đưực tiến hành song Intrõn 22 bắng phương pháp Inversion PCR. Kết quả sọng với mẫu đối chứng. Nếu m âu đối chứng xuất có 19/45 bệnh nhân có đột biến đảo đoạn chiếm tỷ lệ hiện vạch DNA tương ứng với kích thước của exon 42,2% . được khuếch đại, ĩrong khi mẫu bệnh nhân không xuấỉ ĐC HA HA RA BA HA HA HA M hiện vạch thỉ bệnh nhân bị đột biến m ất đoạn exort đó. 02 33 07 12 2 0 3 3 55 3.3.4. Phát hiện đột biến điểm bằng kỹ thuật giải trình tự gen Được thực hiện theo qui trình sử dụng phương SOObp ss%p phốp BigDye terminator sequencing (Applied 4S7fcp Bỉosysíems, Foster city USA). V iệc phân tích kểt quả dựa vào sự so sánh trình tự geri cua bệnh nhan với trình tự gen chuẩn của Gen Bank(nạtỉona! center for biotechnology information, NCBI) bằng phần mềm M : (aark er kich thiròc lOObp CLC. So sánh trinh tự các acid amin của bệnh nhân E C : Mầu đui ch ũ sg ( n g u ô i bìtili tlitròng) HA33, HA3S Không cò ãăc đoạn {iron 22 với trinh tự chuẩn chùa Genbank bằng phần mềm HA02, HA07, HA ù , HA20.HAS5: rô d j< b ú n aio *>}* itroa ĩ ĩ Biast của NCBI. K ÉT QU Ả Hình 1. Hình ảnh điện dĩ sản phẩm PCR xác định đột biến 1. Đ ặ c đ iểm chung về đ ố i tư ợ n g nghiên cứu đảo đoạn ỉnỉron 22 4 5/60 bệnh nhân được chẩn đoán lâm sàng thể Nhận xét: D NA người bình thường ở mẫu đối nặng chiếm tỷ lệ 75% , 10/60 bệnh nhân thể írung bình chứng dương (+) khi được khuếch đại bang phản ứng chiếm tỷ lệ 16,67% , 5/60 bệnh nhân thể nhẹ chĩếm tỷ multiplex P C R có 1 băng kích thước tương ứng 487 lệ 8,33% . bp. Nếu đột biến xảy ra, khi khuếch đại sẽ cho 1 đoạn 2. T ỷ iệ p h át hiện đ ư ợ c đ ộ t biến kích thước 559 bp. N hư vậy, ở vị trí các giếng tương 2.1. Ty iệ bệnh nhân theó k ế t quả p h á t hiện đột ứng với các bệnh nhân m ã số HA33, HA38 không có biến đảo đoạn intron 22 do cùng có vạch DNA kích thước Nghiên cứu phái hiện được 5 4/60 trường hợp 4 8 7 bp. ở giếng mã số HA02, HA07, HA12, HA20, bệnh nhân có đột biến gen F8 gây bệnh hemophilia A HA55 là bệnh nhân hemophiília A có đột biến đảo chiếm tỷ iệ 90% . Số bệnh nhân chưá phát hiện được đoạn intron 22 (hình 1) do điện di đều có vạch DNA là 6/6 0 chiếm tỷ lệ 10%. kích thước 559bp. 2.2. Tỳ lệ độ t biến theo thề bệnh ở nhóm phát 3.1.2. Xác định đột biến đảo đoạn intron 1 bằng hiên và nhóm không p h á t hiện '___________ phương pháp Multiplex PCR H Phối hiện đ ư ợ c ta C h u a phàt hiện đirợ c Có 19/45 bệnh nhân hemophilỉia A thề nặng bị đột 100 .00 % biến đảo đoạn intron 22, 2 6/45 bệnh nhân hemophillỉa 90.0054 80.00% A thể nặng còn lại tiếp tục được sàng lọc đột biển đảo 70.00% đoạn intron 1 thẽo phương pháp multiplex P C R Kết 60.0054 quả 26 bệnh nhân này không bị đột biến đảo đoạn SO.OOSé intron 1. 40.00% - 30.0054 |M | p i M 20.0 0 % M PI P2 PI P2 Pi P2 Ỉ T n M 10.00« 0.00% -1 T ru n g b ìn h Nhẹ Biễuđô í: Tỷ lệ đọt biên theo the bẹnh ở nhóm phát hiện và nhóm chưa phát hiện được 2kb—>\ Nhận xét: Ikb— ụ— 1191bp - Thể nặng: 41/45 bệnh nhân phát hiện được đột biến chiếm tỷ ịệ 91,1% . 4 /4 5 bệnh nhân chưa phát M: Maầer kích thước hiện được đột biến chiếm tỳ !ệ 8,9% . Pi: Phànứng l dặc hiệuchoiníihỉ - Thể trung binh: 9/10 bệnh nhân phát hiện được P2: Phánúng 2dặc hiệuchoiflt!h2 đột biến chiếm tỷ iệ 90% . 1/10 bệnh nhản chưa pháỉ Hình 2. Hỉnh ảnh điện di sản phẩm PCR xác định đảo đoạn hiện được đột biến chiếm tỷ lệ 10%. intron 1 469
  4. Nhận xét: Trong kết quả ở hình 2, các phản ứng 8, exon 9 của bệnh nhân không có vạch D NA trong khi multiplex P C R khuếch đại đoạn Ỉnt1h1 (P 1) chỉ cho các tát cả các exon còn lại đều lên vạch DNA tương ứng đoạn DNA kích thước 1908bp chứng tỏ cặp mồi 9F và với mẫu đổi chứng dương. Đ iều này chứng tò bệnh 9cR thiết kế cho đoạn in tlh l bắt cạp với nhau. Các nhân bị đột biến mat đoạn exon 8 và exon 9. phản ứng khuếch ổại đoạn in t lh i (P 2) ổều cho kích 3.3. K ết quả p h á t hiện đ ộ t biến bằng phư ơ ng thước 1191 bp chứng tỏ chì cỏ cặp mồi int1h-2R và pháp g iả i trình tự ÌnMh-21" hiâi I H-yV/ínạr* in H íy ? wAi 1-jh g ii Ọ oo. /. L ý Ụ i U Ỉ KỉẤ o. n s i i /7/ái U U Ờ i i Ỉ Ỉ U U i & U U U Như vậy, không có đột biến ỉntron 1. ờ các bệnh nhân Đ ột biến mất 15 nucleõtid. mã số HA15, HA46, HA45 và HA24. '• f 5 c.43S459doi15Nu 3.2. K ế t quả p h á t hiện đ ộ t biến m ất exon bằng I p . ttS - ^ S d e lY ty n phản ứng PCR GCTGAGGTTTATGATACAGTGGTCATTACAC' GCTGAGGT^ATTAC Nghiên cứu này có 3 bệnh nhân đột biến mất exon bao gồm HA38, HA51, HA55. - Đột biến mất exon 8 và exon 9 ở bệnh nhân H A 51: Ngtrờibmhthirêng BệnhnfiẵnHA46 Exon7 Exon 8 Exon9 Exon 10 135-139 - Ỷ BN - + BN * + BN - + BN M GtaeBaak 125 E.I£gn0ftSy Y r e m ĩL: « A S E IS G m C S L & S V C L a 3 ^ 1 LLGPT1QASV..........ĨTLKỉmSHPVStHAVGVSríỉ[®SBISCrv'FDSLĨLSVCLHS Hirih 4. Hinh ẫnti đột biên mẫt đoạrí 15 nucieotid ơ bệnih nhân HA46 Nhận xét: Bệnh nhân m ã số HA46 thể nặng, không phát hiện thấy đảo đoạn intron 22, intron 1. khuếch đại 38 cặp mồi đều lên vạch căng, rõ nét. Tinh sạch DNA M: Marker í GObp BN: bệnh nhân của các phản ứng khuếch đại này và giải trình tự, sau 4-: đoi chứng dương - ; đối chứng âm đó so sánh với trình tự người bình thường. Kết quả tại Hình 3. Kết qua PCR xác định đột biến mắt exon ờ bệnh exon 4 phát hiện thấy độí biến mất 15 nucleotid tại vị nhân HA51 trí c.435-450. Khi kiểm tra sự thay đổi acid amin do đột biển gây ra, thấy tại vị trí protein từ 135 đến 139 bị mẩt Nhận xét: Bệnh nhân mã sổ HA51 sau khi được 5 acid amin Tyrosin, Asparagin, Threonỉn, Valin, Valin khuếch đại toàn bộ 38 cặp mồi cùng với các mẫu đổi (p. 135-13 9 d e lí yr-Vai). chứng âm và đối chứng dương phát hiện ở vị trí exon 3.3.2. Đột biến sai nghĩa C.6545 C.6545G>A p.R2182H(Arg 2182 His) I IC A C T C T T C G C A T G G A G T T G . CACTCTTCACATGGAGTTG Ỷ j Người bình thường Bệnh nhân HA59 2182 Q u e ry 2144 VFFG1WDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNS 219: VFFGNVDSSGIKHWIFNPPIIARYIRLHPTHYSIRSTL MELMGCDLNS S b jc t 1 VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLHMELMGCDLNS 49 Hinh 5. Hình ảnh đột biến ờ bệnh nhân mã số HA59 470
  5. Nhận xẻt: Hỉnh ảnh giải trình tự ở bệnh nhân mã số 3.3.5. Đột biến mẩt 1 nucleotìd HA59 cho thấy: có đột biến thay thế rìũcleotid G thành Đột biến m ất nudeotid A: nucleotid A (G>A) trên exon 23 cùa gen F8. So sánh với trình tự Genebank thấy trên exon 23 vị trí C.6545 e.3389deU p.R1130del(Argilỉãđei) G>A, dân đến thay đổi acid amin vị trí p.2182 của protein gen F8 từ Arginin thành Histidin G G AGC CA AA A A AA A TAA C CTT- G G AG C C A A AA A A aV a A C C TT (p.Arg2182His). 3.3.3. Đột biến thêm vô nghĩa Ê ấ k ầ m ề ề ìề ấ N g trờ i b in h th ư ờ n g Bệnh nhãn HA01 - _- mm 1130 C *H T pUUa{UtiíMĩi#tì B I CíBsbiaỉi m e QasĩTaTĩ-iọsD3as5s?asfQKKTEHĩFi& 11ỉ3aĩ8ĩVarjỉYÍLSJiffiỊJĩBFLS¥iTS 1H Ỉ gssiHrĩiBísie RUI 56i Ỗ55ÌTSTTÌỈ5D5K 1020 . TTCTCĨGGAĨAĨACCTTCAAAÍ ĨĨCTCĨG O A ĨAA A CCĨĨCA AA Hình 8. Hình ảnh đột biến mất nucleotid A của bệnh nhân HA01 Nhận xét: Hinh ảnh giải trình tự cho thấy bệnh nhân HA01 có đột biến m at một nucieotid A. So sẩnh với trinh tự G enebank thấỵ mất một nucleotid A tại vị Ĩ Ị4 Í C.3388, dan đến protein yếu tố V íll bi lệch khung dịch mã toàn bộ acid amin từ vị trí p. 1130 (p.Ầrg1130deỉ). CĩMbuk 1W JflUw»}i$£Y^5w«lWttMĨĨwíi3mộ(J .........3 Â 3 .-iỀ 9 L Ế Ể Đ J Ể .y M ị .ũ Ế ................................................................................................. c iì o r cil5J«5a»T m m ssw M m m m m w w m Hình 6. Hình ảnh đột biến tạo stop codon TTTCATGAAGGTTAGTGAGTCTT TTTGATGAAGTTTAGĩCAGTCTT; của bệnh nhân HA33 Nhận xét: Bệnh nhân mã sổ H A 33 sau khi được giải trình tự kiểm tra vị trí đột biến cho thấy: đột biến Ngi^t bình thưửng Bịnh nhin HA4Ỉ thay thế nucleotid T bằng nucỉeotid A tại vị trí 6425. So Hình 9. Hình ảnh độỉ biến tại vị trí nối exon/intron của bệnh sánh với trình tự Genebank cho thấy: đột biến này làm nhân HA45 thay đổi acid amin Leucin tạo thành stop codon gây dừng đột ngột quá trình phiên m ã protein Nhận xét: Với những thay đỗi bầt thường ở gần (p.Leu2142Stop). hoặc tại vị trí đầu hoặc cuối exon là vị írí nối giữa exon 3.3.4. Đột biến thêm một nucleotid v à in íro n 1 3 . Đ ột biến thêm nuđeotid C: 4. Mối liên quan giữa thể bệnh và độỉ biến khác e.2777 e,2777ỉn»c p.S827iiu{lytỉỉ7lnt) nhau trên bệnh nhân hemophillia A 4.1. Tỷ lệ các dạng đột biến phát hiện được trên bệnh nhân hemophillia A__ __ ____________ ____ TTAGGACCCCCAAGTATGCCi TTAGGACCCCCCAAGTATGCC Ngiròiblnli tỉuròng B ệnh nhản H.AQ3 885 'Ã A "SlK K L Ì);K V 3SĨSỉ;ỉÌI,I3Tĩf5D H L A A ữT D :ỉT 5SL 5??r^L D F:
  6. thêm nucleoíid đứng íhứ ba, mỗi loại 6/54 (11,1% ). mở đường cho các nghiên cứu về cơ chế bệnh học - Chiếm tỵ lệ thấp nhất là đột biến tại vị trí nối exon- phân tử hemophilia A và các dạng đột biến gen F8 gây intron, đột biến mất đoạn lớn: mỗi loại 3/54 (5,55% ). bệnh. 4.2. Tỷ lệ các dạng đột biến trông từng thể bệnh X ác định vị trí các đột biến gen F8 ử bệnh nhân hemophilia A cung cẩp nhiều lợi ích cho khoa học cơ 100. 00 % bản và ứng dụng lâm sàng. Đổi với những bệnh nhân on n tĩỊí bị bệnh hemophilia A, xác định được vị trí đột biến là một tiêu chuẩn vàng để khằng định chính xác chẩn 80.00% đoán bệnh, ngoài ra nó cũng hỗ trợ trong việc tiên 70,00% íượng mức độ nghiêm trọng của bệnh và diễn biến lâm .60.00% Sàng7 trong dự báo nguy cơ phát triển các kháng íhể 50.00% kháng FVIII đẻ từ đó lựa chọn phương pháp điều trị tối 40.00% ưu. Hơn nữa, xác định được vị trí đột biến của bệnh 30.00% nhân ià điều kiện tiên quyểt cho việc chẩn đoán trước sinh nhữna phụ nữ mang gen bệnh và tiến hành thiết 20 ,00 % lập bản đo đột biển gen F8 là tiền đề hết sức quan 10.00% trọng cho việc áp đụng liệu pháp điều trị gen trong 0 .00% tương lai để giải quyết triệt để căn bệnh này. Intron 22 đột biến điểm đột biến đỉểm T y lệ p h á t hiện đ ư ợ c đ ộ t biến Trong nghiên cứu này, xác định đột biến trên gen Thể nặng Thể trung bình ĩh ể n h ẹ F8 được thực hiện ở 60 bệnh nhân đã được chần đoán hemophilia A không có quan hệ huyết thống: Có Biểu đồ 3: Tỷ lệ các dạng đột biến trong từng thể bệnh 54 trường hợp phát hiện được đột biến chiếm 90%, 6 (10% ) trường hợp chưa phát hiện được đột biến. Tỷ lệ Nhận xét: chưa phát hiện được đọt biến của chúng tôi cao hơn - Đ ột biến đảo đoạn Intron 22: chỉ gặp ở bệnh nhân các tác giả khác công bổ là 2-7% , nguyên nhân có thể thể nặng: 1 9 /4 5 (4 2 ,2 % ). do chúng tôi chưa phối hợp được các phương pháp - Đ ột biến điểm gặp chù yếu ở thề trung bỉnh 90% khác để chẩn đoán các vị trí đọt biến ờ trong vùng (9/10), thể nhẹ 80% (4/5). intron, chưa xác định được các đọt biến lặp đoạn DNA 4.3. Tỷ lệ đột biến ờ bệnh nhân hemophilia A bằng phương pháp M LPẦ... Tuy nhiên so với các tác thể n ặ n g _____________ giả chì sử dụng phương pháp giải trinh tự gen đơn thuần thì tỷ lệ phảt hiện được đột biến cùa chủng tôi íương đối cao, phù hợp. s ố bệnh nhân phát hiện được 3.90% đột biến ở từng thể bệnh là: Thể nặng 9 1 ,i% , thể trung bình 90% , thể nhẹ 80% . So với tỳ lệ phát hiện * Đào đoạn itron 22 được đột biến cua tác giả Santacroce và cộng sự thực hiện trên 1296 bệnh nhân hemophilia A ở Italia là 874 B Đội biền điềm (89% ), 146 (84% ), 133 (94% ) tứơng ứng bệnh nhận ÍỈSMất đoạn lớn thể nặng, trung bình, nhẹ. [3]. Theo tac gia Bogdanova B Chưa phát hiện cũng chì sừ dụng phương pháp giải trình tự phát hiện đột biến cho kết quả xác định được đột biến từng thể là: 100% íhể nặng, 96% thể trung bình và 8 8% the nhẹ ưl x C ác dạng ỡ ộ ỉ biên g ây bệnh h em o ph ilia A ờ V iệ tN a m T ỉ !ệ các dạng đột biến khác nhau trong nghiên cứu Biễu đồ 5: Tỷ lệ đột biến ở bệnh nhân hemophillia A thể của chúng tôi cho thấy hay gặp nhầt là đảo đoạn intron nặng 22 (35,2% ). Tỷ íệ này tướng tự với tỷ lệ đột biến đảo đoạn intron 22 đã được cong bố 42 - 50% ở nhóm Nhận xét: Bệnh nhân hemophilia A thề nặng: bệnh nhân thể nặng, ở Đài Loan tỷ lệ nảy là 45,1% , - 1 9 / 4 5 (42,2% ) đột biến đảo đoạn Intron 22. 40-50% ở Châu Ấu. - 1 9 / 4 5 (42,2% ) đột biến điềm. ’ Trong nghiên cửu của chủng tôi 26 bệnh nhân - 3/45 (6,7% ) đột biến mất đoạn lớn. không cố đột biến đảo đoạn intron 22 được kiểm tra - 4 /4 5 (8,9% ) chưa phát hiện được đột biến. xác định đột biến đảo đoạn intron 1 bằng kỹ thuật B ÀN LUẬN multiplex P C R cho thấy khong có bệnh nhân nào có Bệnh hemophilia A !à một bệnh di truyền do thiếu đảo đoạn intron 1. Chúng tôi cho rằng với kểt luận âm hụt hoặc bất thường chức năng của yếu tố đông máu tính có thể cỡ mẫu của chúng tôi chưa đủ lớn để phát huyết tương - yếu tố Vill. T ừ năm 1984, nghiên cứu hiện đột biển này. Trong nghiên cứu của Andrikòvỉcs của Gitschier đã cho thấy những hiểu biết đầy đủ về cũng cho thấy kết quả âm tính với loại đột biển này khi cấu trúc phân từ gen F8 tổng hợp protein yếu tố VIII, nghiên cứu írên 104 bệnh nhân hemophilia A ở 472
  7. Hungari. Nghiên cứu trên bệnh nhân hemophilia A ờ đoạn, chl gặp đột biến điểm 90% ở thể trung bình, Ắn Đ ộ thấy ỉỷ ịệ đột biến iníron 1 ià 2,7% , tương tự 80% ở thể nhẹ. nghiên cứu ờ Nam Phi các đột biến này chỉ tim thầy ở - Chưa phát hiện được đột biến đảo đoạn in tro n l. bệnh nhân da đen m à không tìm ìhấy ở bệnh nhân da KIẾN NGHỊ trắng. Tuy nhiên, đảo đoạn intron 1 là một đột biến 1. Thiết lập và quản lý cơ sờ dữ liệu về bệnh nhân quan trọng cần sàng lọc, m ặc dù tỷ íệ phát hiện trong và người mang gen bệnh hemophilia A. quần thể người da trắng thấp. 2. T ư vấn di truyền trước hôn nhân và chẩn đoán Sau khi thu được D N A có chất lượng tốt chúng tôi trước sinh cho những người mang gen bệnh trước - sử dụng kỹ thuật P C R với 38 cặp mối đặc hiệu cho 26 trong quá trinh mang thai. exon cua gen F8 và phát hiện được 3 bệnh nhân bị đột TÀI LIỆU THAM KHẢO biến mất ẽxon chiếm tỷ íệ 5,55% . Với 23 bệnh nhân 1. Adoración Venceslá, Maria Angeles Corral- thể nặng, 10 bệnh nhân thể trung bình và 5 bệnh nhân Rodriguez, Manei Baena, Mónica Comet, Montserrat thể nhẹ sừ dụng kỹ thật giải trinh tự gen để xác định Domènech, Montserrat Baiget, Pablo Fuentes-Prior, các loại đột biến điểm cho kết quả: dạng đột biến sai Eduardo F, Tizzano. (2008). identification of 31 novel nghĩa 20,4% , đột biến m ất /thêm nucieotid và đột biến mutations in the F8 gene in Spanish hemophilia A vô nghĩa có cùng tì lệ 11,1% ; đột biến vị trí nối và đột patients: structural analysis of 20 sai nghĩa mutations biến mẩt đoạn lớn có tì lệ là 5,55% trong số bệnh nhân suggests new intermoiecular binding sites. Blood, 111(7), phái hiện được đột biến. C ác ioại đột biển được tỉm 3468-3478. thấy tỉ ỉệ phù hợp với các kết quả báó cáo được công 2. Brockway W l, Olson ID, Fass DN, Bowie JW, Mann KG. (1977). Purification of porcine and human ristocetin- bố bởi các tác giả R epesse [9], Jochen Graw [5], Wiilebrand factor. LabClin Med, 89,1278-1294. Adoracion Venceia [1], Rosetti [8]. 3. Castaman G, Margaglione M, Morfini M, Rocino A, Santagostino E, Tagarielio G, Mannucci PM. (2008). The cứu khác trên thế cỊịới Italian AICE-Genetics hemophilia A daỉabase:results and Pháp Đức Tây Argentina Nghiên correlation with clinical phenotype. Haematologica. 93(5), [9] [53 Ban [83 cứu này 722-728. 120 845 Nha C1] BN BN 260 BN 60 BN 4. Chang SP, Ma GC, Chen M, Kuo SJ, Chang c s , 267 BN inỉron 22 46,0% 35,7% Shen MC. (2008). The spectrum of ỉhe factor 8 (F8) 43% 44% 35,2% Sai nghĩa 15,0% 38,2% defects in Taiwanese patients with haemophilia A. 34% 12,2% 20,4% Vị trí nối 7,0% 2,6% Haemophiiia, 14,787-795. 2,6% 3,7% 5,55% Vô nghĩa 13,0% 9,3% 5. Hans Hermann, Brackmann, Jochen Graw, 3,7% 10,2% 11,1% Thêm Johannes Oldenburg. (2005). Heamophilia A: from 7,0% 2,6% 2,0% 1,9% 11,1% mutation analysis to new therapies. Nature reviews nucleoíid Mát Genetics, 6,488-501. 10,0% 7,5% 7,8% 15,9% 11,1% 6. Kazazian HH, Jr Lakich D, Antonarakis SE, nucleotid Mât đoạn Gitschier J. (1993). Inversions disrupting the factor VIII 2,0% 3,0% 1,0% 10,2% 5,55% gene are a common cause of severe haemophilia A. Nat lớn Genet, 5,236-241 K Ế T LUẬN 7. Markoff A, Bogdanova N, Poilmann H. (2005). Spectrum of molecular defects and mutation detection Nghiên cứu phát hiện đột biến gen F8 trên 60 bệnh rate in patients with severe hemophilia A. Hum Mutat, 26, nhân bằng sử dụng kết hợp 4 phương pháp khác 249-254. nhau, chúng tôi rút ra được kểt luận sau: 8. Rossetti LC, Szurkalo i, Radio CP. (2013). Factor 1. P hát hiện đ ộ t bỉến g en F8 ờ bệnh nhân VIII genotype characterization of haemophilia A affected hemophilia A của Việt Nam patiens with transient and permanent inhibitors: a - Tỷ lệ phát hiện được đột biến là 9 0% (54/60 bệnh comprehensive Argentine study of inhibitor risks. nhân), trong đó tỉ íệ phát hiện đột biến ở thể nặng Haematoiogica, 19,115-118. 91,1% , ờ the trung bình 9 0% và ở thể nhẹ 80%. 9. Repesse Y, Slaoui M, Ferrandis M, Gautier p, - Các dạng đột biến được phát hiện bao gồm: đảo Costa c , Lavergne JM, Derlon AB. (2007). Factor Vlli đoạn iníron 22 là 35,2% (1 9/54 bệnh nhân), đột biến (FVIil) gene mutations in 120 patients with hemophilia A: sai nghĩa ià 20,4% (11/54 bệnh nhân), đột biến mất detection of 26 novel mutations and correlation with FVIII nucleotid là 11,1 % (6/54 bệnh nhân), đột biến vô nghĩa inhibitor development. Thrombosis and Haemostasis, 5, là 11,1% (6/54 bệnh nhân), đột biến thêm nucleotid là 1469-1476. 11,1% (6/54 bệnh nhân), đột biến vị trí nối exon-iníron 10. Schwaab R, Becker J, Moiler-Taube A, Schwaab là 5,55% (3/54 bệnh nhân), đột biến m ất đoạn lớn là u, Schmidt w , Brackmann HH, Gn'mm T, Oiek K, 5,55% (3/54 bệnh nhân), Oldenburg J. (1996). Characterization of the factor VIII 2. Tỷ iệ đột biến p h á t hiện đ ư ợ c với th ể lâm defect in 147 patients with sporadic hemophilia A: family sàng studies indicate a mutation type-ependent sex ratio of mutation frequencie. Am J Hum Genet, 58(4), 657-670. - Thể nặng: phát hiện được đột biến đảo đoạn 11. Yang T, Liu w , Zhao w , Chase GA. (2007). intron 22 lá cao nhất chiếm tỉ lẹ 42,2% , đột bien mất Accounting for Genotyping Errors in Tagging SNP đoạn lớn là 6,7% , đột biến điểm ià 42,2% . Selection. Annals of Human Genetics, 71(4), 467-479. - Thể trung bình, thể nhẹ không có đột biến đảo 473
ADSENSE

CÓ THỂ BẠN MUỐN DOWNLOAD

 

Đồng bộ tài khoản
2=>2